Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005165-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005165-M01, RRID:AB_425584
- Product name
- PDK3 monoclonal antibody (M01), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PDK3.
- Antigen sequence
GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLC
EQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFH
MLFELFKNSMRATVELYEDR- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Additive effects of clofibric acid and pyruvate dehydrogenase kinase isoenzyme 4 (PDK4) deficiency on hepatic steatosis in mice fed a high saturated fat diet.
Induction of pyruvate dehydrogenase kinase-3 by hypoxia-inducible factor-1 promotes metabolic switch and drug resistance.
Pyruvate dehydrogenase kinase-4 deficiency lowers blood glucose and improves glucose tolerance in diet-induced obese mice.
Hwang B, Wu P, Harris RA
The FEBS journal 2012 May;279(10):1883-93
The FEBS journal 2012 May;279(10):1883-93
Induction of pyruvate dehydrogenase kinase-3 by hypoxia-inducible factor-1 promotes metabolic switch and drug resistance.
Lu CW, Lin SC, Chen KF, Lai YY, Tsai SJ
The Journal of biological chemistry 2008 Oct 17;283(42):28106-14
The Journal of biological chemistry 2008 Oct 17;283(42):28106-14
Pyruvate dehydrogenase kinase-4 deficiency lowers blood glucose and improves glucose tolerance in diet-induced obese mice.
Jeoung NH, Harris RA
American journal of physiology. Endocrinology and metabolism 2008 Jul;295(1):E46-54
American journal of physiology. Endocrinology and metabolism 2008 Jul;295(1):E46-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PDK3 monoclonal antibody (M01), clone 2B11 Western Blot analysis of PDK3 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PDK3 expression in transfected 293T cell line by PDK3 monoclonal antibody (M01), clone 2B11.Lane 1: PDK3 transfected lysate(46.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PDK3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol