H00029796-M07

UQCR10 antibody from Abnova Corporation
HSPC051, QCR9, UCCR7.2, UCRC

Antibody data

Product number
H00029796-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029796-M07, RRID:AB_1581699
Product name
UCRC monoclonal antibody (M07), clone 2B5
Provider product page
Abnova Corporation - H00029796-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant UCRC.
Antigen sequence
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERA
FDQGADAIYDHINEGKLWKHIKHKYENK
Isotype
IgG
Antibody clone number
2B5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -