HPA015128

B4GALNT1 antibody from Atlas Antibodies
beta1-4GalNAc-T, GALGT, SPG26
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015128
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015128, RRID:AB_1845243
Product name
Anti-B4GALNT1
Provider product page
Atlas Antibodies - HPA015128
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYS
SRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRL
YPPGSLPQGAQYNISALVTIATKTFLRYDRLRALI
TSIRRFYPTVTVVIADDSDKPERVSGPYV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -