MBS2003639

PF4 antibody from MyBioSource
CXCL4, SCYB4
Western blot
Recommended by provider
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
MBS2003639
Provider
MyBioSource
Product name
Polyclonal Antibody to Platelet Factor 4 (PF4)
Provider product page
MyBioSource - MBS2003639
Antibody type
Polyclonal
Reactivity
Rat
Host
Rabbit
Antigen sequence
The target protein is fused with tw
o N-terminal Tags, His-tag and its
sequence is listed below.MHHHHHHSSG
LVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAM
ADIGSEF-V TRASPEESDG DLSCVCVKTS SSR
IHLKRIT SLEVIKAGPH CAVPQLIATL KNGSK
ICLDR QVPLYKKIIK KLLES
Isotype
IgG
Vial size
0.1 mg
Concentration
200μg/ml
Storage
Store at 4°C for frequent use. Stored at -20°C to -80°C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -