AV41840

LSS antibody from Sigma-Aldrich
OSC
No application information provided.

Antibody data

Product number
AV41840
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV41840, RRID:AB_1853390
Product name
Anti-LSS (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV41840
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human LSS with an internal ID of P10888
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFAT
YETKRGGHLLELLNP
Storage
-20C
Provider Type Product Number
- No reagents -