HPA010636

CD164 antibody from Atlas Antibodies
DFNA66, MGC-24, MUC-24
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010636
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010636, RRID:AB_888816
Product name
Anti-CD164
Provider product page
Atlas Antibodies - HPA010636
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCE
GRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTV
SDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSP
STTSKTVTTSGTTNNTVTPTS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -