HPA010636

CD164 antibody from Atlas Antibodies
DFNA66, MGC-24, MUC-24
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010636
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010636, RRID:AB_1078447
Product name
Anti-CD164
Provider product page
Atlas Antibodies - HPA010636
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCE
GRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTV
SDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSP
STTSKTVTTSGTTNNTVTPTS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -