HPA010636

CD164 antibody from Sigma-Aldrich
DFNA66, MGC-24, MUC-24
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010636
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010636, RRID:AB_1078447
Product name
Anti-CD164 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010636
Antibody type
Polyclonal
Antigen
Putative mucin core protein 24 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCE
GRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTV
SDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSP
STTSKTVTTSGTTNNTVTPTS
Storage
-20C
Provider Type Product Number
- No reagents -