HPA021945

DYSF antibody from Atlas Antibodies
FER1L1, LGMD2B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021945
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021945, RRID:AB_1847928
Product name
Anti-DYSF
Provider product page
Atlas Antibodies - HPA021945
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLL
GIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTD
ELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLS
QITEAALALKLGHSELPAALEQAEDWLLRLRALA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -