HPA017071

DYSF antibody from Sigma-Aldrich
FER1L1, LGMD2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017071
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017071, RRID:AB_1847927
Product name
Anti-DYSF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017071
Antibody type
Polyclonal
Antigen
Dysferlin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IVVELYDHDTYGADEFMGRCICQPSLERMPRLAWF
PLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQ
ETSRILDESEDTDLPYPPPQREANIYMVPQNIKPA
LQRTAIEILAWG
Storage
-20C
Provider Type Product Number
- No reagents -