Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014420 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-EPGN
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPI
ALKFSHLCLEDHNSYCINGACAFHHELEKAICRCF
TGYTGERCEHLTLTSYAVDSYE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Co-expression and prognostic significance of putative CSC markers CD44, CD133, wild-type EGFR and EGFRvIII in metastatic colorectal cancer
The impact of co-expression of wild-type EGFR and its ligands determined by immunohistochemistry for response to treatment with cetuximab in patients with metastatic colorectal cancer
Khelwatty S, Essapen S, Bagwan I, Green M, Seddon A, Modjtahedi H
Oncotarget 2019;10(18):1704-1715
Oncotarget 2019;10(18):1704-1715
The impact of co-expression of wild-type EGFR and its ligands determined by immunohistochemistry for response to treatment with cetuximab in patients with metastatic colorectal cancer
Khelwatty S, Essapen S, Bagwan I, Green M, Seddon A, Modjtahedi H
Oncotarget 2016;8(5):7666-7677
Oncotarget 2016;8(5):7666-7677
No comments: Submit comment
No validations: Submit validation data