HPA014420

EPGN antibody from Sigma-Aldrich
ALGV3072, EPG, epigen, PRO9904
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014420
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014420, RRID:AB_10601551
Product name
Anti-EPGN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014420
Antibody type
Polyclonal
Antigen
epithelial mitogen homolog (mouse) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALTEEAAVTVTPPITAQQGNWTVNKTEADNIEGPI
ALKFSHLCLEDHNSYCINGACAFHHELEKAICRCF
TGYTGERCEHLTLTSYAVDSYE
Storage
-20C
Provider Type Product Number
- No reagents -