HPA013695

GNS antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013695
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013695, RRID:AB_1849741
Product name
Anti-GNS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013695
Antibody type
Polyclonal
Antigen
N-acetylglucosamine-6-sulfatase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCE
DAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYN
LTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSG
PTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF
Storage
-20C
Provider Type Product Number
- No reagents -