HPA013898

WNT10A antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013898
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013898, RRID:AB_1858847
Product name
Anti-WNT10A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013898
Antibody type
Polyclonal
Antigen
Protein Wnt-10a precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YESPIFSRGFRESAFAYAIAAAGVVHAVSNACALG
KLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKG
LSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGE
RFSKDFLDSR
Storage
-20C
Provider Type Product Number
- No reagents -