HPA029831

CAGE1 antibody from MilliporeSigma / Merck KGaA
bA69L16.7, CT95, CTAG3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029831
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029831, RRID:AB_10600876
Product name
Anti-CAGE1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029831
Antibody type
Polyclonal
Antigen
cancer antigen 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSVSYEKEVTAEGVERPEIVSTWSSAGISWRSEAC
RENCEMPDWEQSAESLQPVQEDMALNEVLQKLKHT
NRKQEVRIQELQCSNL
Storage
-20C
Provider Type Product Number
- No reagents -