Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001719-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001719-M01, RRID:AB_565642
- Product name
- DHFR monoclonal antibody (M01), clone 2B10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DHFR.
- Antigen sequence
HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVY
KEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKY
KLLPEYPGVLSDVQEEKGIKYKFEVYEKND- Isotype
- IgG
- Antibody clone number
- 2B10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Effect of soluble guanylyl cyclase activator and stimulator therapy on nitroglycerin-induced nitrate tolerance in rats.
The sodium-glucose co-transporter 2 inhibitor empagliflozin improves diabetes-induced vascular dysfunction in the streptozotocin diabetes rat model by interfering with oxidative stress and glucotoxicity.
Inflammatory monocytes determine endothelial nitric-oxide synthase uncoupling and nitro-oxidative stress induced by angiotensin II.
Influence of reduced folate carrier and dihydrofolate reductase genes on methotrexate-induced cytotoxicity.
Telomere capping in non-dividing yeast cells requires Yku and Rap1.
Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes.
Jabs A, Oelze M, Mikhed Y, Stamm P, Kröller-Schön S, Welschof P, Jansen T, Hausding M, Kopp M, Steven S, Schulz E, Stasch JP, Münzel T, Daiber A
Vascular pharmacology 2015 Aug;71:181-91
Vascular pharmacology 2015 Aug;71:181-91
The sodium-glucose co-transporter 2 inhibitor empagliflozin improves diabetes-induced vascular dysfunction in the streptozotocin diabetes rat model by interfering with oxidative stress and glucotoxicity.
Oelze M, Kröller-Schön S, Welschof P, Jansen T, Hausding M, Mikhed Y, Stamm P, Mader M, Zinßius E, Agdauletova S, Gottschlich A, Steven S, Schulz E, Bottari SP, Mayoux E, Münzel T, Daiber A
PloS one 2014;9(11):e112394
PloS one 2014;9(11):e112394
Inflammatory monocytes determine endothelial nitric-oxide synthase uncoupling and nitro-oxidative stress induced by angiotensin II.
Kossmann S, Hu H, Steven S, Schönfelder T, Fraccarollo D, Mikhed Y, Brähler M, Knorr M, Brandt M, Karbach SH, Becker C, Oelze M, Bauersachs J, Widder J, Münzel T, Daiber A, Wenzel P
The Journal of biological chemistry 2014 Oct 3;289(40):27540-50
The Journal of biological chemistry 2014 Oct 3;289(40):27540-50
Influence of reduced folate carrier and dihydrofolate reductase genes on methotrexate-induced cytotoxicity.
Yoon SA, Choi JR, Kim JO, Shin JY, Zhang X, Kang JH
Cancer research and treatment : official journal of Korean Cancer Association 2010 Sep;42(3):163-71
Cancer research and treatment : official journal of Korean Cancer Association 2010 Sep;42(3):163-71
Telomere capping in non-dividing yeast cells requires Yku and Rap1.
Vodenicharov MD, Laterreur N, Wellinger RJ
The EMBO journal 2010 Sep 1;29(17):3007-19
The EMBO journal 2010 Sep 1;29(17):3007-19
Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes.
Ionova IA, Vásquez-Vivar J, Whitsett J, Herrnreiter A, Medhora M, Cooley BC, Pieper GM
American journal of physiology. Heart and circulatory physiology 2008 Nov;295(5):H2178-87
American journal of physiology. Heart and circulatory physiology 2008 Nov;295(5):H2178-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DHFR monoclonal antibody (M01), clone 2B10 Western Blot analysis of DHFR expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DHFR monoclonal antibody (M01), clone 2B10. Western Blot analysis of DHFR expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10.Lane 1: DHFR transfected lysate(21.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DHFR is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to DHFR on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol