HPA015607

KIAA0319 antibody from Sigma-Aldrich
NMIG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015607
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015607, RRID:AB_1852299
Product name
Anti-KIAA0319 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015607
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA0319 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GRTYSNAVISPNLETTRIMRVSHTFPVVDCTAACC
DLSSCDLAWWFEGRCYLVSCPHKENCEPKKMGPIR
SYLTFVLRPVQRPAQLLDYGDMMLNRGSPSGIWGD
SPEDIRKDLPFLGKDWGLEEMSEYSDDYRELEKDL
LQPSG
Storage
-20C
Provider Type Product Number
- No reagents -