H00004113-B01

MAGEB2 antibody from Abnova Corporation
CT3.2, DAM6, MAGE-XP-2, MGC26438

Antibody data

Product number
H00004113-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004113-B01, RRID:AB_1204644
Product name
MAGEB2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00004113-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MAGEB2 protein.
Antigen sequence
MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEE
EEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAA
AAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKS
PSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKI
VGKRFREHFPEILKKASEGLSVVFGLELNKVNPNG
HTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGV
IFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPW
KLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAY
AETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEE
KAGV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -