H00092949-B01

ADAMTSL1 antibody from Abnova Corporation
ADAMTSR1, C9orf94, FLJ35283

Antibody data

Product number
H00092949-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00092949-B01, RRID:AB_1203937
Product name
ADAMTSL1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00092949-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ADAMTSL1 protein.
Antigen sequence
MECCRRATPGTLLLFLAFLLLSSRTARSEEDRDGL
WDAWGPWSECSRTCGGGASYSLRRCLSSKSCEGRN
IRYRTCSNVDCPPEAGDFRAQQCSAHNDVKHHGQF
YEWLPVSNDPDNPCSLKCQAKGTTLVVELAPKVLD
GTRCYTESLDMCISGLCQIVGCDHQLGSTVKEDNC
GVCNGDGSTCRLVRGQYKSQLSATKSDDTVVAIPY
GSRHIRLVLKGPDHLYLETKTLQGTKGENSLSSTG
TFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIR
NSGSADSTVQFIFYQPIIHRWRETDFFPCSATCGG
GYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPK
LQECNLDPCPARWEATPWTACSSSCGGGIQSRAVS
CVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC
PKWLAQEWSPVTVPSFFVH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -