HPA013432

DNAJC1 antibody from Sigma-Aldrich
DNAJL1, ERdj1, MTJ1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013432
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013432, RRID:AB_1847797
Product name
Anti-DNAJC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013432
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily C member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDLSQLTRSMVKFPGGTPGRWEKIAHELGRSVTDV
TTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKT
ATTLPDDMITQREDAEGVAAEEEQEGDSGEQETGA
TDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFD
IAEQNESS
Storage
-20C
Provider Type Product Number
- No reagents -