HPA013432

DNAJC1 antibody from Atlas Antibodies
DNAJL1, ERdj1, MTJ1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013432
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013432, RRID:AB_1847797
Product name
Anti-DNAJC1
Provider product page
Atlas Antibodies - HPA013432
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EDLSQLTRSMVKFPGGTPGRWEKIAHELGRSVTDV
TTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKT
ATTLPDDMITQREDAEGVAAEEEQEGDSGEQETGA
TDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFD
IAEQNESS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -