HPA035814

CLEC16A antibody from MilliporeSigma / Merck KGaA
Gop-1, KIAA0350
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035814
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035814, RRID:AB_10600801
Product name
Anti-CLEC16A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035814
Antibody type
Polyclonal
Antigen
C-type lectin domain family 16, member A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPYFSNLVWFIGSHVIELDDCVQTDEEHRNRGKLS
DLVAEHLDHLHYLNDILIINCEFLNDVLTDHLLNR
LFLPLYVYSLENQDKGGERPKISLPVSLYLLSQVF
L
Storage
-20C
Provider Type Product Number
- No reagents -