Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051126-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051126-M01, RRID:AB_606637
- Product name
- NAT5 monoclonal antibody (M01), clone 2C6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant NAT5.
- Antigen sequence
MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQY
LAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEW
HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGG
FFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSA
SNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPE
DIE- Isotype
- IgG
- Antibody clone number
- 2C6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
Identification of the human N(alpha)-acetyltransferase complex B (hNatB): a complex important for cell-cycle progression.
Van Damme P, Lasa M, Polevoda B, Gazquez C, Elosegui-Artola A, Kim DS, De Juan-Pardo E, Demeyer K, Hole K, Larrea E, Timmerman E, Prieto J, Arnesen T, Sherman F, Gevaert K, Aldabe R
Proceedings of the National Academy of Sciences of the United States of America 2012 Jul 31;109(31):12449-54
Proceedings of the National Academy of Sciences of the United States of America 2012 Jul 31;109(31):12449-54
Identification of the human N(alpha)-acetyltransferase complex B (hNatB): a complex important for cell-cycle progression.
Starheim KK, Arnesen T, Gromyko D, Ryningen A, Varhaug JE, Lillehaug JR
The Biochemical journal 2008 Oct 15;415(2):325-31
The Biochemical journal 2008 Oct 15;415(2):325-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NAT5 monoclonal antibody (M01), clone 2C6 Western Blot analysis of NAT5 expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NAT5 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol