HPA014245

MYOF antibody from Sigma-Aldrich
FER1L3, KIAA1207
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014245
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014245, RRID:AB_1848495
Product name
Anti-MYOF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014245
Antibody type
Polyclonal
Antigen
Myoferlin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDE
GDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVK
NSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
Storage
-20C
Provider Type Product Number
- No reagents -