Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014245 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014245, RRID:AB_1848495
- Product name
- Anti-MYOF
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDE
GDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVK
NSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Loss of myoferlin redirects breast cancer cell motility towards collective migration.
Isolation and Characterization of Progenitor-Like Cells from Human Renal Proximal Tubules
Volakis LI, Li R, Ackerman WE 4th, Mihai C, Bechel M, Summerfield TL, Ahn CS, Powell HM, Zielinski R, Rosol TJ, Ghadiali SN, Kniss DA
PloS one 2014;9(2):e86110
PloS one 2014;9(2):e86110
Isolation and Characterization of Progenitor-Like Cells from Human Renal Proximal Tubules
Lindgren D, Boström A, Nilsson K, Hansson J, Sjölund J, Möller C, Jirström K, Nilsson E, Landberg G, Axelson H, Johansson M
The American Journal of Pathology 2011 February;178(2):828-837
The American Journal of Pathology 2011 February;178(2):828-837
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-431 and HEK293 using Anti-MYOF antibody. Corresponding MYOF RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & vesicles.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cervix, uterine and testis tissues using Anti-MYOF antibody. Corresponding MYOF RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows low expression as expected.
- Sample type
- HUMAN