HPA014245

MYOF antibody from Atlas Antibodies
FER1L3, KIAA1207
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014245
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014245, RRID:AB_1848495
Product name
Anti-MYOF
Provider product page
Atlas Antibodies - HPA014245
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDE
GDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVK
NSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -