Antibody data

Product number
H00079895-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079895-M08, RRID:AB_1137100
Product name
ATP8B4 monoclonal antibody (M08), clone 4D5
Provider product page
Abnova Corporation - H00079895-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ATP8B4.
Antigen sequence
IMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVD
FSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRL
LALCHTVMSEENSAGELI
Isotype
IgG
Antibody clone number
4D5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -