Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405457 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Myosin, Heavy Polypeptide 10, Non-Muscle (MYH10) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MYH10 antibody: synthetic peptide directed towards the N terminal of human MYH10
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKAD
FCIIH YAGKVDYKAD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Dystrophin deficiency in canine X-linked muscular dystrophy in Japan (CXMDJ) alters myosin heavy chain expression profiles in the diaphragm more markedly than in the tibialis cranialis muscle.
Yuasa K, Nakamura A, Hijikata T, Takeda S
BMC musculoskeletal disorders 2008 Jan 9;9:1
BMC musculoskeletal disorders 2008 Jan 9;9:1
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting