HPA011129

NDST4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011129
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011129, RRID:AB_1079460
Product name
Anti-NDST4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011129
Antibody type
Polyclonal
Antigen
Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GYKQEMTLIETTAEAECTDIKILPYRSMELKTVKP
IDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQ
Storage
-20C
Provider Type Product Number
- No reagents -