H00154007-B01

SNRNP48 antibody from Abnova Corporation
C6orf151, dJ336K20B.1, dJ512B11.2, FLJ32234

Antibody data

Product number
H00154007-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00154007-B01, RRID:AB_1137874
Product name
C6orf151 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00154007-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C6orf151 protein.
Antigen sequence
MEGEPPPVEERRRLQEELNEFVESGCRTLEEVTAS
LGWDLDSLDPGEEEAAEDEVVICPYDSNHHMPKSS
LAKHMASCRLRKMGYTKEEEDEMYNPEFFYENVKI
PSITLNKDSQFQIIKQARTAVGKDSDCYNQRIYSS
LPVEVPLNHKRFVCDLTQADRLALYDFVVEETKKK
RSDSQIIENDSDLFVDLAAKINQDNSRKSPKSYLE
ILAEVRDYKRRRQSYRAKNVHITKKSYTEVIRDVI
NVHMEELSNHWQEEQEKAEDDAEKNEERRSASVDS
RQSGGSYLDAECSRHRRDRSRSPHKRKRNKDKDKN
CESRRRKERDGERHHSHKRRKQKI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -