HPA034785

OBI1 antibody from MilliporeSigma / Merck KGaA
C13orf7, FLJ13449, RNF219
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034785
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034785, RRID:AB_10601496
Product name
Anti-RNF219 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034785
Antibody type
Polyclonal
Antigen
ring finger protein 219 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKGSLTNDQLENGSEWKPTSFFLLSPSDQEMNEDF
SLHSSSCPVTNEIKPPSCLFQTEFSQGILLSSSHR
LFEDQRFGSSLFK
Storage
-20C
Provider Type Product Number
- No reagents -