HPA037724

ACOT12 antibody from Atlas Antibodies
Cach, STARD15, THEAL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037724
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037724, RRID:AB_2675631
Product name
Anti-ACOT12
Provider product page
Atlas Antibodies - HPA037724
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CIHWDISKQASLSDSNVEALKKLAAKRGWEVTSTV
EKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSD
FTKRPLWDPHFVSCEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -