WH0010042M1

HMGXB4 antibody from Sigma-Aldrich
HMG2L1, THC211630
ELISA
Recommended by provider

Antibody data

Product number
WH0010042M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0010042M1, RRID:AB_1841965
Product name
Monoclonal Anti-HMG2L1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0010042M1
Antibody type
Monoclonal
Antigen
HMG2L1 (NP_001003681, a.a. 1-75) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKR
SYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTD
THKK* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -