Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010042-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010042-M03, RRID:AB_565836
- Product name
- HMG2L1 monoclonal antibody (M03), clone 3C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HMG2L1.
- Antigen sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKR
SYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTD
THKK- Isotype
- IgG
- Antibody clone number
- 3C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to HMGXB4 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to HMG2L1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol