H00010042-M03

HMGXB4 antibody from Abnova Corporation
HMG2L1, THC211630

Antibody data

Product number
H00010042-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010042-M03, RRID:AB_565836
Product name
HMG2L1 monoclonal antibody (M03), clone 3C12
Provider product page
Abnova Corporation - H00010042-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HMG2L1.
Antigen sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKR
SYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTD
THKK
Isotype
IgG
Antibody clone number
3C12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -