H00010042-A01

HMGXB4 antibody from Abnova Corporation
HMG2L1, THC211630
No application information provided.

Antibody data

Product number
H00010042-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010042-A01, RRID:AB_535230
Product name
HMG2L1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00010042-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant HMG2L1.
Antigen sequence
MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKR
SYKDFLREEEEIAAQVRNSSKKKLKDSELYFLGTD
THKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -