HPA000725

HMGXB4 antibody from Atlas Antibodies
HMG2L1, THC211630
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000725
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000725, RRID:AB_611542
Product name
Anti-HMGXB4
Provider product page
Atlas Antibodies - HPA000725
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSY
KDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTH
KKKRKHSSDDYYYGDISSLESSQKKKKKSSPQSTD
TAMDLLKAITSPLAAGSKPSKKTGEKSSGSSSHSE
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -