HPA000725

HMGXB4 antibody from Sigma-Aldrich
HMG2L1, THC211630
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000725
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000725, RRID:AB_1079073
Product name
Anti-HMGXB4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000725
Antibody type
Polyclonal
Antigen
High mobility group protein 2-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSY
KDFLREEEEIAAQVRNSSKKKLKDSELYFLGTDTH
KKKRKHSSDDYYYGDISSLESSQKKKKKSSPQSTD
TAMDLLKAITSPLAAGSKPSKKTGEKSSGSSSHSE
S
Storage
-20C
Provider Type Product Number
- No reagents -