HPA011281

FRAS1 antibody from MilliporeSigma / Merck KGaA
FLJ14927, FLJ22031, KIAA1500
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011281
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA011281, RRID:AB_1849127
Product name
Anti-FRAS1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA011281
Antibody type
Polyclonal
Antigen
Extracellular matrix protein FRAS1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVNEKKVRFVHSKEKLRKGYLFLKISDQQFFSEPQ
LINIQAFSTQAPYVLRNEVLHISRGERATITTQML
DIRDDDNPQDVVIEIIDPPLHGQLLQTLQSPAT
Storage
-20C
Provider Type Product Number
- No reagents -