HPA034980

TAB3 antibody from MilliporeSigma / Merck KGaA
MAP3K7IP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034980
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034980, RRID:AB_10602708
Product name
Anti-MAP3K7IP3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034980
Antibody type
Polyclonal
Antigen
mitogen-activated protein kinase kinase kinase 7 interacting protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNP
TTVFKITVGRATTENLLNLVDQEERSAAPEPIQPI
SVIPGSGGEKGSHKYQRSSSSGSDDYA
Storage
-20C
Provider Type Product Number
- No reagents -