HPA011130

CCDC90B antibody from Atlas Antibodies
MDS011, MDS025
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011130
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011130, RRID:AB_1846170
Product name
Anti-CCDC90B
Provider product page
Atlas Antibodies - HPA011130
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AHLDAIRKDMVILEKSEFANLRAENEKMKIELDQV
KQQLMHETSRIRADNKLDINLERSRVTDMFTDQEK
QLMETTTEFTKKDTQTKSIISETSNKIDAEIASLK
TLMESNKLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -