HPA011931

CCDC90B antibody from Sigma-Aldrich
MDS011, MDS025
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011931
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011931, RRID:AB_2072332
Product name
Anti-CCDC90B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011931
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 90B, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MNSRQAWRLLLSQGRGDRWVSRPRGHFSPALRREF
FTTTTKEGYDRRPVDITPLEQRKLTFDTHALVQDL
ETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQ
AQQEITVQQL
Storage
-20C
Provider Type Product Number
- No reagents -