Antibody data

Product number
H00023181-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023181-M01, RRID:AB_1137176
Product name
DIP2A monoclonal antibody (M01), clone 4E6
Provider product page
Abnova Corporation - H00023181-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DIP2A.
Antigen sequence
KYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASE
DEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSST
SSSASSTSSHPGGRPTTAPSAAATPGAAATTALAG
LEAHTHIDLHSAPPDVTTGLVEHSYFERPQVASVR
SVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLK
RPKRPPLKEFFVDDFEELLE
Isotype
IgG
Antibody clone number
4E6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -