HPA009975

RMDN3 antibody from Sigma-Aldrich
FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009975
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009975, RRID:AB_1078811
Product name
Anti-FAM82A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009975
Antibody type
Polyclonal
Antigen
Protein FAM82C (Protein tyrosine phosphatase-interacting protein 51) (TCPTP-interacting protein 51) (Cerebral protein 10).
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGS
SGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNK
LVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYAL
DGKEEAEAALEKGDESADCHLWYAVLCG
Storage
-20C
Provider Type Product Number
- No reagents -