H00029066-B01

ZC3H7A antibody from Abnova Corporation
FLJ20318, HSPC055, ZC3H7, ZC3HDC7

Antibody data

Product number
H00029066-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029066-B01, RRID:AB_1139127
Product name
ZC3H7A MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00029066-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZC3H7A protein.
Antigen sequence
MKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKE
NGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQG
HISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDR
YMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKL
NKARKDHLIGPNDNDFGKYSFLFKDLN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -