HPA011014

GLIPR1 antibody from Sigma-Aldrich
GliPR, RTVP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011014
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011014, RRID:AB_1849714
Product name
Anti-GLIPR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011014
Antibody type
Polyclonal
Antigen
Glioma pathogenesis-related protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPAL
AQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
IWTGSVPIFSVSSAITNWYDEIQDYDF
Storage
-20C
Provider Type Product Number
- No reagents -