H00004283-M06

CXCL9 antibody from Abnova Corporation
CMK, crg-10, Humig, MIG, SCYB9

Antibody data

Product number
H00004283-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004283-M06, RRID:AB_1574175
Product name
CXCL9 monoclonal antibody (M06), clone 1F5
Provider product page
Abnova Corporation - H00004283-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CXCL9.
Antigen sequence
TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPS
CEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQ
VSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Isotype
IgG
Antibody clone number
1F5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -