ABIN630484

antibody from antibodies-online

Targeting: GCNT3 C2/4GnT, C2GnT-M, C2GnT2

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630484 - Provider product page
Provider: antibodies-online
Product name: anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) antibody
Antibody type: Polyclonal
Antigen: GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

GCNT3 protein structure - ABIN630484 shown in red.