HPA011154

GCNT3 antibody from Atlas Antibodies
C2/4GnT, C2GnT-M, C2GnT2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011154
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011154, RRID:AB_888433
Product name
Anti-GCNT3
Provider product page
Atlas Antibodies - HPA011154
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKR
SINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDT
HYLSLTRDCEHFKAERKFIQFPLSKEEVEFPIAYS
MVIHEKIENFER
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -