HPA011154

GCNT3 antibody from Sigma-Aldrich
C2/4GnT, C2GnT-M, C2GnT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011154
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011154, RRID:AB_1078961
Product name
Anti-GCNT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011154
Antibody type
Polyclonal
Antigen
Glucosaminyl(N-acetyl) transferase 3, mucin type recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLKCDSDHLGLESRESQSQYCRNILYNFLKLPAKR
SINCSGVTRGDQEAVLQAILNNLEVKKKREPFTDT
HYLSLTRDCEHFKAERKFIQFPLSKEEVEFPIAYS
MVIHEKIENFER
Storage
-20C
Provider Type Product Number
- No reagents -