H00005921-M01
antibody from Abnova Corporation
Targeting: RASA1
CM-AVM, GAP, p120, p120GAP, p120RASGAP, RASA
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005921-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005921-M01, RRID:AB_463790
- Product name
- RASA1 monoclonal antibody (M01), clone 2C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RASA1.
- Antigen sequence
AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPD
TTEHSRTDLSRDLAALHEICVAHSDELRTLSNERG
AQQHVLKKLLAITELLQQKQNQYTKTNDVR- Isotype
- IgG
- Antibody clone number
- 2C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RASA1 monoclonal antibody (M01), clone 2C12 Western Blot analysis of RASA1 expression in IMR-32 ( Cat # L008V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RASA1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RASA1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol