HPA012624

RHOT2 antibody from Sigma-Aldrich
ARHT2, C16orf39, MIRO-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012624
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012624, RRID:AB_1856272
Product name
Anti-RHOT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012624
Antibody type
Polyclonal
Antigen
Mitochondrial Rho GTPase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQE
KGQTQRSVLLCKVVGACGVGKSAFLQAFLGRGLGH
QDTREQPPGYAIDTVQVNGQEKYLILC
Storage
-20C
Provider Type Product Number
- No reagents -