Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405902 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chromosome 17 Open Reading Frame 80 (C17orf80) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C17orf80 antibody: synthetic peptide directed towards the N terminal of human C17orf80
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTI
PTDQK VYQSKPATLP- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of genes related to Parkinson's disease using expressed sequence tags.
Kim JM, Lee KH, Jeon YJ, Oh JH, Jeong SY, Song IS, Kim JM, Lee DS, Kim NS
DNA research : an international journal for rapid publication of reports on genes and genomes 2006 Dec 31;13(6):275-86
DNA research : an international journal for rapid publication of reports on genes and genomes 2006 Dec 31;13(6):275-86
No comments: Submit comment
No validations: Submit validation data